DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp2

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:108 Identity:30/108 - (27%)
Similarity:51/108 - (47%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVAL-FALAVADV--------QILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDE 57
            ||:::...: .|.|:|.|        .:|.:..||....|:....||:|....|:|....     
  Fly     3 KFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAHG----- 62

  Fly    58 EALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPVV 100
               |:.|.:.:::.:|:...:.|.|:||||||.||.:|..|.:
  Fly    63 ---NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 13/54 (24%)
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.