DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr11B

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:70 Identity:29/70 - (41%)
Similarity:48/70 - (68%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLP 95
            ::|:|::|.:|......|:.:. |....:|.|:|:||:..|||:.|::.||||:||:..:|||||
  Fly    84 NYNFGFDTGNGIHRDETGEFRG-GWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFHAEGAHLP 147

  Fly    96 VAPVV 100
            |:|.|
  Fly   148 VSPSV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 20/54 (37%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.