DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr11A

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster


Alignment Length:130 Identity:37/130 - (28%)
Similarity:52/130 - (40%) Gaps:45/130 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFALAVADVQILKQE---------SDV-----------------GPV--------- 30
            ||..::.:...|||.|||:.|...         ||:                 |.|         
  Fly     1 MKSFLILLGFAALAAADVKHLTDRNLDLFKYNPSDIYTLPEDIDDDKPAVHFSGDVMKAKTETLQ 65

  Fly    31 SFNYG------YETSDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAYTADENGYQP 89
            ::|.|      .:|.:|....:.|:||    |::...|.|:|||...||:.|...|||||.||.|
  Fly    66 NYNSGKKFKLELKTQNGIEVSSVGKLK----DDKTFVVSGSYSFTGADGKRYKTRYTADEFGYHP 126

  Fly    90  89
              Fly   127  126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 21/60 (35%)
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.