DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr65Av

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:102 Identity:49/102 - (48%)
Similarity:70/102 - (68%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVFVALFAL-------AVADVQ---ILKQESD-VGPVSFNYGYETSDGSSAQAAGQLKNVGTDEE 58
            ::.:..|||       .:.|.|   ||:.::| :|...:|:|||||||.:.|...::||.|||:|
  Fly     8 VLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQE 72

  Fly    59 ALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLP 95
            ||:|:|:.|:||.|||||::.|.|||||:||||.|||
  Fly    73 ALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 32/54 (59%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 32/54 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.