DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and LOC1276149

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:XP_315459.4 Gene:LOC1276149 / 1276149 VectorBaseID:AGAMI1_000569 Length:137 Species:Anopheles gambiae


Alignment Length:100 Identity:47/100 - (47%)
Similarity:61/100 - (61%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVFVALFALAV------ADVQILKQESDVGP-VSFNYGYETSDGSSAQAAGQLKNVGTDEEALN 61
            |.|..||.|:|.      |..|:|..:|.|.| .|:||.||||:|.:||.:|    ||    ..:
Mosquito     4 LFVIAALVAVAAAQNPQDAQAQVLASDSVVNPDGSYNYRYETSNGLAAQESG----VG----GQS 60

  Fly    62 VKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPV 96
            .:|:||:..|||..|.::|.|||||:|||||||||
Mosquito    61 AQGSYSYTGDDGVQYQVSYVADENGFQPQGAHLPV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 24/54 (44%)
LOC1276149XP_315459.4 Chitin_bind_4 39..86 CDD:459790 24/54 (44%)

Return to query results.
Submit another query.