DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsx1 and Dfd

DIOPT Version :10

Sequence 1:NP_001012251.1 Gene:gsx1 / 449875 ZFINID:ZDB-GENE-041008-135 Length:243 Species:Danio rerio
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:82 Identity:45/82 - (54%)
Similarity:56/82 - (68%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish   116 PDPRQFHCISIENSSSQL-QSSKRMRTAFTSTQLLELEREFTSNMYLSRLRRIEIATYLNLSEKQ 179
            |..::.|...:.|.|.|. ...||.|||:|..|:||||:||..|.||:|.||||||..|.|||:|
  Fly   345 PWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQ 409

Zfish   180 VKIWFQNRRVKHKKEGK 196
            :||||||||:|.||:.|
  Fly   410 IKIWFQNRRMKWKKDNK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsx1NP_001012251.1 Homeodomain 137..193 CDD:459649 37/55 (67%)
DfdNP_477201.1 Homeodomain 367..423 CDD:459649 37/55 (67%)

Return to query results.
Submit another query.