powered by:
Protein Alignment pex10 and Topors
DIOPT Version :9
Sequence 1: | NP_001005994.1 |
Gene: | pex10 / 449821 |
ZFINID: | ZDB-GENE-041010-71 |
Length: | 318 |
Species: | Danio rerio |
Sequence 2: | NP_001261083.1 |
Gene: | Topors / 37188 |
FlyBaseID: | FBgn0267351 |
Length: | 1038 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 23/64 - (35%) |
Similarity: | 34/64 - (53%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Zfish 257 QSSSRTSRCILCLEE-RRNTTSTPCGHLFCWECITEWCNTKNECPLCREKFQP--HRLVYLRSY 317
:.:|....|.:||.. ||...:..|.|.||::|:.||...|.|||||::.|:. |.:..|..|
Fly 94 ERNSPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQPFRTIIHNVRTLDDY 157
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
pex10 | NP_001005994.1 |
Pex2_Pex12 |
18..237 |
CDD:282595 |
|
zf-RING_2 |
265..303 |
CDD:290367 |
17/38 (45%) |
Topors | NP_001261083.1 |
RING |
102..144 |
CDD:238093 |
18/41 (44%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23350 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.