DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom40 and tomm40l

DIOPT Version :9

Sequence 1:NP_001259313.1 Gene:Tom40 / 44978 FlyBaseID:FBgn0016041 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_031746850.1 Gene:tomm40l / 100496551 XenbaseID:XB-GENE-958939 Length:307 Species:Xenopus tropicalis


Alignment Length:292 Identity:131/292 - (44%)
Similarity:187/292 - (64%) Gaps:3/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KDAALENPGTVEELHKKCKDIQAITFEGAKIMLNKGLSNHFQVSHTINMSNVVPSGYRFGATYVG 117
            |...|.|||:.:|||:.||::.....||.|:::||.||:||||||:|:||.|..|.|.|.|.|||
 Frog    19 KRVPLPNPGSFDELHRSCKEVFPQQMEGVKLIINKPLSSHFQVSHSIHMSTVGQSSYHFNAKYVG 83

  Fly   118 TKEFSPTEAFPVLLGDIDPAGNLNANVIHQFSARLRCKFASQIQESKVVASQLTTDYRGSDYTLS 182
            ..:.||||.||:|.||:|.||:|||.:....:.|.|.|...|...||.:..|:..:|||.|.|::
 Frog    84 DYQPSPTETFPMLTGDVDNAGSLNAQIHCLLADRFRSKAVFQTYRSKFLTWQVDGEYRGDDCTVT 148

  Fly   183 LTVANPSIFTNSGVVVGQYLQSVTPALALGSELAYQFGPNVPGRQIAIMSVVGRYTAGSSVWSGT 247
            ||:.||.|...|.::|..:|||:||.|.||.||.|.   ...|.:.||.::.|:|:|.:.|.:..
 Frog   149 LTLGNPDILNESVILVTHFLQSITPRLVLGGELVYH---QRMGEEGAIFTMAGKYSAPNWVATLN 210

  Fly   248 LGQSGLHVCYYQKASDQLQIGAEVETSLRMQESVATLAYQIDLPKANLVFRGGIDSNWQIFGVLE 312
            :|..|.|..||.:|::|:.:|.|:|.:.|:||:.....|.:|:||||:||:|.:|::|.:.|:||
 Frog   211 IGYGGAHASYYHRANEQIHVGVELEANTRLQETSFAFGYHLDIPKANVVFKGSVDNSWCVGGILE 275

  Fly   313 KRLAPLPFTLALSGRMNHVKNNFRLGCGLMIG 344
            |:|.|||.||||...|||.||.|..|..:|:|
 Frog   276 KKLPPLPVTLALGAFMNHWKNKFHCGFNIMVG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom40NP_001259313.1 Porin3_Tom40 57..344 CDD:132766 129/286 (45%)
tomm40lXP_031746850.1 Porin3_Tom40 23..307 CDD:132766 129/286 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 319 1.000 Domainoid score I1243
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2297
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 1 1.000 - - FOG0001620
OrthoInspector 1 1.000 - - mtm9447
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1729
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.