DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stk25a and Pak

DIOPT Version :9

Sequence 1:XP_005165982.1 Gene:stk25a / 449653 ZFINID:ZDB-GENE-041010-92 Length:424 Species:Danio rerio
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:283 Identity:120/283 - (42%)
Similarity:176/283 - (62%) Gaps:4/283 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish     4 LQNIRNQNSRLNPEEYFTKLERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEIT 68
            |:.:|...|..:|...:||:|:||:|:.|.||..|.:.|...||||.::|.: :.:.|.|..||.
  Fly   550 LEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEIL 613

Zfish    69 VLSQCDSPYVTKYYGSYLTGSKLWIIMEYLGGGSALDLLRPGTLEEVYIATILREILKGLDYLHS 133
            |:.:...|.|..|..|||...:||::||||.|||..|::....::|..||.:.||:|:.|::||:
  Fly   614 VMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHA 678

Zfish   134 ERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADI 198
            .:.||||||:.|:||...|.|||.|||...|::..|.||.|.||||:||||||:.:..|..|.|:
  Fly   679 NQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDL 743

Zfish   199 WSLGITAIELAKGEPPNAELHPMRVLFLIPKNNPPTL--EGSYSKAFKDFVEACLNKEPRFRPTA 261
            |||||.|||:.:||||....:|::.|:||..|..|.:  :...|.||:||::.||..|...|.:|
  Fly   744 WSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASA 808

Zfish   262 KELLKHKFITRYTKKTSYLSELI 284
            .:||||.|: :..:..:.|:.||
  Fly   809 LDLLKHPFL-KLARPLASLTPLI 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stk25aXP_005165982.1 STKc_MST3_like 20..291 CDD:270786 116/267 (43%)
S_TKc 20..270 CDD:214567 112/251 (45%)
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 115/261 (44%)
S_TKc 566..817 CDD:214567 112/251 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.