DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and AT3G61010

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001319810.1 Gene:AT3G61010 / 825272 AraportID:AT3G61010 Length:427 Species:Arabidopsis thaliana


Alignment Length:205 Identity:45/205 - (21%)
Similarity:72/205 - (35%) Gaps:55/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IQSYINANLAKSYDYLLLATHFNSYQKNR------------PGFQKLYQGLSD--RSFEDSIALI 117
            :|:...::|........|.|.|:|...|.            |..|...|.|..  ...||:..:|
plant    48 VQTIHKSSLFTRISIRALVTMFHSKVSNSQIVAFSFILHRCPMVQHFCQSLQPLLELNEDNKDVI 112

  Fly   118 KQVTRRGGIVDFNTRHES--SGSVSTKRGTLEVD----------ELH------SLALALDTEKQL 164
             |.|       .:||..|  .|...|.||.||.|          .||      :::.::.:::..
plant   113 -QAT-------LDTREASFNGGDYITFRGKLEGDAYFTTRLFKSHLHLSSSPITISFSVTSDETS 169

  Fly   165 ATGATHVHSRATHATDA---ERDPELAHYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSV 226
            ..|.....|..:|.|.:   .|...:.. |...||...|.|.:.:|.:.        |.:.||  
plant   170 KHGILLSFSSPSHETKSILVSRQESICR-FNNMFLQCLATSAQTVSEWT--------VQETSL-- 223

  Fly   227 YLFDEYLQKQ 236
             :.|:::|.|
plant   224 -VLDDHVQYQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 43/199 (22%)
AT3G61010NP_001319810.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.