DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and FER4

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_181559.1 Gene:FER4 / 818622 AraportID:AT2G40300 Length:259 Species:Arabidopsis thaliana


Alignment Length:210 Identity:49/210 - (23%)
Similarity:79/210 - (37%) Gaps:40/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACSTSAFSALTGFF---------------TGKTNSICNARFAGIDHIEPEIQSYINANLAKSYDY 81
            |..:|...||:|..               |....|:...:::  |..|..|...||.....||.|
plant    53 ASKSSTTDALSGVVFEPFKEVKKELDLVPTSSHLSLARQKYS--DECEAAINEQINVEYNVSYVY 115

  Fly    82 LLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVDFNT--------RHESSGS 138
            ..:..:|:.......|..|.::..|....|.:..|::...:|||.|...:        .|...| 
plant   116 HAMYAYFDRDNIALKGLAKFFKESSLEEREHAEKLMEYQNKRGGRVKLQSIVMPLSEFEHVDKG- 179

  Fly   139 VSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELAHYFEENFLGKQAESV 203
                      |.|:.:.|||..||.:.....::||.|:    ...|..||.:.|..||.:|.|::
plant   180 ----------DALYGMELALSLEKLVNEKLLNLHSVAS----KNNDVHLADFIESEFLTEQVEAI 230

  Fly   204 RKLSGYANDLAKLMK 218
            :.:|.|...|.::.|
plant   231 KLISEYVAQLRRVGK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 42/167 (25%)
FER4NP_181559.1 Euk_Ferritin 94..254 CDD:153114 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.