DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and LOC680520

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_001057542.2 Gene:LOC680520 / 680520 RGDID:1590640 Length:170 Species:Rattus norvegicus


Alignment Length:111 Identity:25/111 - (22%)
Similarity:49/111 - (44%) Gaps:10/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVDFNTRHESSGS 138
            :|..|:.||.:|..|.: .|..|.|.:.::.|::...||:.|.:|.:.:|...:...|..     
  Rat    22 HLHTSHVYLAMAYSFRN-DKRIPPFVEYFETLANTRREDADAFLKHLWKRNTAICPPTLE----- 80

  Fly   139 VSTKRGTLEV-DELHSLALALDTEKQLATGATHVHSRATHATDAER 183
               |...:|: ..:.::.||.:.|:.|.:....:...|...:|..|
  Rat    81 ---KVDMMEITTPIEAILLAQEMERTLTSILVGLQGAARRESDLLR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 25/111 (23%)
LOC680520XP_001057542.2 Euk_Ferritin 8..153 CDD:153114 25/111 (23%)
Ferritin 13..143 CDD:278632 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.