DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and Ftmt

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_080562.2 Gene:Ftmt / 67634 MGIID:1914884 Length:237 Species:Mus musculus


Alignment Length:174 Identity:47/174 - (27%)
Similarity:77/174 - (44%) Gaps:22/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQK--LYQGLSDRSFEDSIALIKQVTRRGG- 125
            |..|...||..|..||.||.:|.:|:........|.|  |.|.|.:|  |.:..|:|...:||| 
Mouse    73 EAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYFLRQSLEER--EHAEKLMKLQNQRGGR 135

  Fly   126 --IVDFNTRHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELA 188
              :.|.....:......          |.::..||..||.:......:|:.|:.    :.||.|.
Mouse   136 ICLQDIKKPDKDDWECG----------LRAMECALLLEKNVNQSLLDLHTLASE----KGDPHLC 186

  Fly   189 HYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDEY 232
            .:.|.::|.:|.:|:::|..:.::|. .|..|...|:.||||::
Mouse   187 DFLETHYLHEQVKSIKELGDHVHNLV-TMGAPAAGLAEYLFDKH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 47/172 (27%)
FtmtNP_080562.2 Euk_Ferritin 69..229 CDD:153114 47/172 (27%)
Ferritin 73..211 CDD:278632 39/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3743
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.