DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and fth1b

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001004562.1 Gene:fth1b / 447823 ZFINID:ZDB-GENE-040912-30 Length:177 Species:Danio rerio


Alignment Length:175 Identity:47/175 - (26%)
Similarity:75/175 - (42%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVD 128
            |..|...|...|..||.||.:..:|:...|:.|.|.|.::..|....|.:..|:....:|||.:.
Zfish    14 EAAINRQIYLELYASYVYLSMGYYFDRDDKSLPNFAKFFRDQSKEEREHAEKLMSLQNQRGGRIF 78

  Fly   129 FN-----TRHE-SSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPEL 187
            ..     .|.| .||             |.:|..||..||.:......:|..||.    ..||.:
Zfish    79 LQDIKKPDRDEWGSG-------------LEALECALALEKSVNLSLLELHKVATQ----HNDPHV 126

  Fly   188 AHYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDEY 232
            ..:.|.::|.:|.:|:::||.:...|.: |..|..:::.||||.:
Zfish   127 CDFLETHYLDEQVKSIKELSDWVGSLRR-MGAPQNNMAEYLFDRH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 47/173 (27%)
fth1bNP_001004562.1 Euk_Ferritin 10..170 CDD:153114 47/173 (27%)
Ferritin 14..155 CDD:278632 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.