DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and Fthl17c

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001078994.1 Gene:Fthl17c / 434727 MGIID:3705221 Length:176 Species:Mus musculus


Alignment Length:174 Identity:40/174 - (22%)
Similarity:75/174 - (43%) Gaps:24/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVD 128
            |..|.::|...|..||.|:.:|.:|:.....:..|::.:...|......:...:....:|||.:.
Mouse    17 EDAINTHIQLRLYASYVYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCIS 81

  Fly   129 FN--TRHESSGSVSTKRGTLEVDELH----SLALALDTEKQLATGATHVHSRATHATDAERDPEL 187
            ..  .|.|.             |..|    ::..|...|..:.....::|..|..    :.||.|
Mouse    82 LQDIARPER-------------DSWHGGFQAMECAFHMEMLINQSLLNMHEVAKE----KGDPHL 129

  Fly   188 AHYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDE 231
            .|:.|:|.|.:|.:.::::|||..:|.::..| :.:|:.||||:
Mouse   130 CHFLEQNCLDQQVDILKEMSGYLTNLRQMGAV-EHNLAEYLFDK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 40/174 (23%)
Fthl17cNP_001078994.1 Euk_Ferritin 13..173 CDD:153114 40/174 (23%)
Ferritin 17..158 CDD:278632 34/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.