DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and MGC75752

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_989212.1 Gene:MGC75752 / 394820 -ID:- Length:178 Species:Xenopus tropicalis


Alignment Length:178 Identity:50/178 - (28%)
Similarity:78/178 - (43%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AGIDHIEPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTR 122
            |||:.|       .|..|..||.||.|..:|:........|.|.|:.||::..:.:..|:|...:
 Frog    17 AGINRI-------ANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNK 74

  Fly   123 RGGIV---DFNTRHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRAT-HATDAER 183
            |||.|   |............||          ::.:||:.||.:......:|..|| ||     
 Frog    75 RGGRVVLQDIKKPDADEWGNGTK----------AMEVALNLEKSVNQALLDLHKIATDHA----- 124

  Fly   184 DPELAHYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDE 231
            ||.:..|.|..||.::.:.::||..:..:| |.:|..:..:..||||:
 Frog   125 DPHMCDYLEREFLEEEVKIIKKLGDHLTNL-KRVKAAEDGMGEYLFDK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 48/176 (27%)
MGC75752NP_989212.1 Euk_Ferritin 12..172 CDD:153114 50/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.