DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and Ripor2

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001014031.2 Gene:Ripor2 / 306934 RGDID:1306939 Length:1310 Species:Rattus norvegicus


Alignment Length:244 Identity:62/244 - (25%)
Similarity:89/244 - (36%) Gaps:59/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ACLGSLALAKDDE------YCQN---TVITACSTSAFSALTGFFTGKTNSICNARFAGIDHIEPE 66
            |||...:|...:.      .||:   .:.|..|.:..|......:..|:.|   |......:|..
  Rat  1105 ACLALKSLEATESIKMLVTLCQSDTEEIRTVASETLLSLAPYSGSAMTSQI---RQNYSTEVEAA 1166

  Fly    67 IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVDFNT 131
            :...:|.:|..||.||.|...|:                     .|.:||  :...|||...|..
  Rat  1167 VNRLVNLHLRASYTYLSLGFFFD---------------------PDDVAL--EGNERGGRALFQD 1208

  Fly   132 RHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELAHYFEENFL 196
            ..:.|.....|  |||..|   .||||  ||.|......:|:..:    |..||.|..:.|.:||
  Rat  1209 VQKPSQDEWGK--TLEAME---AALAL--EKNLNQALLDLHALGS----ARTDPHLCDFLESHFL 1262

  Fly   197 GKQAESVRKLSGYANDLAKLMKVPDP----------SLSVYLFDEYLQK 235
            .|:.:.::|:   .|.|..|.:|..|          ||..|||:....|
  Rat  1263 DKEVKLIKKM---GNHLTNLRRVAGPQPAQTGVAQASLGEYLFERLTLK 1308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 49/181 (27%)
Ripor2NP_001014031.2 PL48 118..529 CDD:292525
Involved in cell filopodia formation. /evidence=ECO:0000250|UniProtKB:Q9Y4F9 196..254
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..639
PI-PLCc_GDPD_SF <963..>1097 CDD:301322
Ferritin_like 1160..1304 CDD:294190 49/180 (27%)
Ferritin 1164..1282 CDD:278632 42/154 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.