DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and ftn-2

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_491198.1 Gene:ftn-2 / 171934 WormBaseID:WBGene00001501 Length:170 Species:Caenorhabditis elegans


Alignment Length:173 Identity:46/173 - (26%)
Similarity:73/173 - (42%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IEPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIV 127
            :|..:...||..|..||.||.::.:|:......|...|.::..||...|.:..|::....|||.|
 Worm    12 VEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRV 76

  Fly   128 DFNTRHESSGSVSTKRGTLEVDE----LHSLALALDTEKQLATGATHVHSRATHATDAERDPELA 188
            ......:.           |.||    |.:...||..||........:||.|.:..||    .|.
 Worm    77 VLQDIQKP-----------ENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDA----HLT 126

  Fly   189 HYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDE 231
            .:.||.:|.:|.:|:.:   :|..:|.|.:| .|.:..|:||:
 Worm   127 DFIEEKYLDEQVKSINE---FARMVANLKRV-GPGVGEYVFDK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 46/173 (27%)
ftn-2NP_491198.1 Euk_Ferritin 9..166 CDD:153114 46/173 (27%)
Ferritin 13..154 CDD:278632 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.