DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and LOC108352322

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_038944683.1 Gene:LOC108352322 / 108352322 RGDID:11424835 Length:182 Species:Rattus norvegicus


Alignment Length:166 Identity:40/166 - (24%)
Similarity:65/166 - (39%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 INANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGG---IVDFNTR 132
            |..||:.:|.||   |:..|......||....|..|..|:..:.:::|.:|.||.   |.|....
  Rat    23 IQMNLSDAYLYL---TYLYSDDSTATGFGAYVQDKSLTSWFYAQSVLKYITGRGNKVCIPDIQRP 84

  Fly   133 H-ESSGSVSTKRGTLEVDE-----LHSLALALDTEKQLATGATHVHSRATHATDAERDPELAHYF 191
            . ::.|.:......|.:::     ||.|   ||....:....|..||:.........:..||...
  Rat    85 EIDTQGRIQCAMAALNMEKELKVILHRL---LDLALNIKDNQTLNHSKDWIFKQQRNEERLAREI 146

  Fly   192 EENFLGKQAESVRKLSG--YANDLAKLMKVPDPSLS 225
            :|....:||:: |.:..  |.....:.|...:||.|
  Rat   147 DELKKKEQAQN-RAVEDETYLQGSPRKMPRREPSAS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 40/166 (24%)
LOC108352322XP_038944683.1 Euk_Ferritin 10..157 CDD:153114 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.