DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2LCH and LOC100360087

DIOPT Version :9

Sequence 1:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_002729599.1 Gene:LOC100360087 / 100360087 RGDID:2322860 Length:183 Species:Rattus norvegicus


Alignment Length:183 Identity:52/183 - (28%)
Similarity:76/183 - (41%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IEPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIV 127
            :|..:...:|.:|..||.||.|...|:.......|....::.|::...|.:..|:|....|||..
  Rat    13 VEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLKLQNERGGRA 77

  Fly   128 DFNTRHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELAHYFE 192
            .|....:.|.....|  |||..|   .||||  ||.|......:|:..:    |..||.|..:.|
  Rat    78 LFQDVQKPSQDEWGK--TLEAME---AALAL--EKNLNQALLDLHALGS----ARTDPHLCDFLE 131

  Fly   193 ENFLGKQAESVRKLSGYANDLAKLMKVPDP----------SLSVYLFDEYLQK 235
            .:||.|:.:.::|:   .|.|..|.:|..|          ||..|||:....|
  Rat   132 SHFLDKEVKLIKKM---GNHLTNLRRVAGPQPAQTGVAQASLGEYLFERLTLK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 51/178 (29%)
LOC100360087XP_002729599.1 Ferritin 10..177 CDD:153098 51/177 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.