DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actn3 and MICALL2

DIOPT Version :10

Sequence 1:NP_524801.1 Gene:Actn3 / 44964 FlyBaseID:FBgn0015008 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_891554.1 Gene:MICALL2 / 79778 HGNCID:29672 Length:904 Species:Homo sapiens


Alignment Length:100 Identity:26/100 - (26%)
Similarity:51/100 - (51%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 SLLRWCQERVKPY-GIPMYEFSASWISGRALCAIIHSYLPDLIDKTYLAKKKPEEVLAYGIKVAK 511
            :|.:||:::.:.| .:.:...:.|:..|.|.|||:|.:.||||:.:.|.|:...|......:||:
Human     6 ALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLAFRVAE 70

  Fly   512 S-IGVSDSVDLIRELRQGRPNLEKIVDFVEELQGY 545
            . :|:...:|....:....|:...|:.:|.:...|
Human    71 EHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Actn3NP_524801.1 SMC_N <13..277 CDD:481474
CH_SF 443..540 CDD:469584 24/93 (26%)
MICALL2NP_891554.1 Forms an intramolecular interaction with the C-terminal coiled coil domain keeping the protein in a closed conformation. /evidence=ECO:0000250 1..260 25/99 (25%)
CH_MICALL2 2..107 CDD:409102 25/99 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..178
LIM_Mical_like_1 188..241 CDD:188828
PHA03247 <243..649 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..722
Mediates targeting to the cell plasma membrane. /evidence=ECO:0000250 261..697
Necessary and sufficient for interaction with actinins. /evidence=ECO:0000250 261..388
Forms an intramolecular interaction with the N-terminal Calponin-homology and LIM zinc-binding domains-containing region keeping the protein in a closed conformation. /evidence=ECO:0000250 698..807
bMERB_dom 743..872 CDD:463467
Mediates interaction with RAB13 and is required for transition from the closed to the opened conformation. /evidence=ECO:0000250 807..903
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.