DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp70Ba and Hspa1a

DIOPT Version :10

Sequence 1:NP_731716.1 Gene:Hsp70Ba / 44921 FlyBaseID:FBgn0013277 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_034609.2 Gene:Hspa1a / 193740 MGIID:96244 Length:641 Species:Mus musculus


Alignment Length:116 Identity:23/116 - (19%)
Similarity:50/116 - (43%) Gaps:27/116 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EEIENMTELCPTHLDEQLSEER-------------AKAKAALEAKLAKQLKQMQAKHRKEIKEAE 132
            |:|.|..:    .:||.::|.:             .|.:..||| |...:|:|....|.::|..|
Mouse    37 EDIRNSID----KIDENVAEVKKLYSVILSAPTSDQKTQDDLEA-LTNDIKKMANNARNKLKTIE 96

  Fly   133 MAKTIRSTKKTKVGKNGKIAKVDKKTAKTVKEKQVLDLPQPKIEINDEDID 183
              :.:.:.:..:|..:.:|    :|:...|..::.:|:   ..:.|:..:|
Mouse    97 --RNLETEEVERVSADMRI----RKSQHAVLSRKFVDV---MTKYNEAQVD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp70BaNP_731716.1 PTZ00009 2..641 CDD:240227 23/116 (20%)
Hspa1aNP_034609.2 PTZ00009 1..641 CDD:240227 23/116 (20%)
Nucleotide-binding domain (NBD). /evidence=ECO:0000250|UniProtKB:P11142 2..386 23/116 (20%)
Substrate-binding domain (SBD). /evidence=ECO:0000250|UniProtKB:P11142 394..509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..641
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.