DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and MLC1

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_011409.1 Gene:MLC1 / 852772 SGDID:S000003074 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:48/136 - (35%)
Similarity:82/136 - (60%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLI-AEAENNNNGQLNFTEFCGIMAKQM 76
            ||.|..|||:|.|.||...||..:|.:|.|||...:||:| |::...:...|...:..|::....
Yeast     8 KDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNE 72

  Fly    77 RETDT-----EEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMI 136
            :|.|.     .|:..:||::||::..|.:|..:||:::..||||:||.|:||:::..:.|.:|.|
Yeast    73 KELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEI 137

  Fly   137 NYEEFV 142
            :|::|:
Yeast   138 DYKKFI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 48/136 (35%)
EFh 11..73 CDD:238008 23/60 (38%)
EFh 84..146 CDD:238008 22/59 (37%)
MLC1NP_011409.1 FRQ1 1..149 CDD:227455 48/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.