DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and CMD1

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_009667.1 Gene:CMD1 / 852406 SGDID:S000000313 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:74/146 - (50%)
Similarity:112/146 - (76%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFT 66
            |.||||||||||:||..|||:..|.|::.||.|:||:||.:|:|||:.||:.|.:.:.|.|:.|:
Yeast     3 SNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFS 67

  Fly    67 EFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFD 131
            ||..:|::|::..|:|:|:.||||:||::|||.||.|||:.|:.::|||:||.|:|:|:||.. |
Yeast    68 EFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVS-D 131

  Fly   132 GDGMINYEEFVWMISQ 147
            |.|.||.::|..::|:
Yeast   132 GSGEINIQQFAALLSK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 73/145 (50%)
EFh 11..73 CDD:238008 29/61 (48%)
EFh 84..146 CDD:238008 32/61 (52%)
CMD1NP_009667.1 PTZ00184 1..145 CDD:185504 73/142 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345834
Domainoid 1 1.000 82 1.000 Domainoid score I1952
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I904
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46902
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.