DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and CAM4

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001185330.1 Gene:CAM4 / 842959 AraportID:AT1G66410 Length:159 Species:Arabidopsis thaliana


Alignment Length:156 Identity:95/156 - (60%)
Similarity:124/156 - (79%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEG----------TGKIATRELGTLMRTLGQNPTEAELQDLIAEAEN 57
            :||:|||:|||:||..|||:|          .|.|.|:||||:||:||||||||||||:|.|.:.
plant     4 QLTDEQISEFKEAFSLFDKDGDDSISDSGDSCGCITTKELGTVMRSLGQNPTEAELQDMINEVDA 68

  Fly    58 NNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEID 122
            :.||.::|.||..:|||:|::||:|||::|||::||:|.:||||.||||.||.|||||:||||::
plant    69 DGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVE 133

  Fly   123 EMIREADFDGDGMINYEEFVWMISQK 148
            |||||||.||||.|||||||.::..|
plant   134 EMIREADVDGDGQINYEEFVKIMMAK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 94/154 (61%)
EFh 11..73 CDD:238008 37/71 (52%)
EFh 84..146 CDD:238008 44/61 (72%)
CAM4NP_001185330.1 PTZ00184 1..159 CDD:185504 94/154 (61%)
EFh <36..84 CDD:238008 28/47 (60%)
EFh 95..157 CDD:238008 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.