DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and AT1G62820

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_176470.1 Gene:AT1G62820 / 842581 AraportID:AT1G62820 Length:148 Species:Arabidopsis thaliana


Alignment Length:139 Identity:58/139 - (41%)
Similarity:93/139 - (66%) Gaps:2/139 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68
            |:.:|::..|:||:.||.:|.||||..|||.|||:||.||||::|:.:|  ...|.:...:|..|
plant     6 LSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSII--TTENLSSPFDFNRF 68

  Fly    69 CGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGD 133
            ..:|||.::....:.::|:|||:.|::|.||::.|:||.::.::|||:...|.||.|:|.|...|
plant    69 LDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLQPSEFDEWIKEVDVGSD 133

  Fly   134 GMINYEEFV 142
            |.|.||:|:
plant   134 GKIRYEDFI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 58/139 (42%)
EFh 11..73 CDD:238008 27/61 (44%)
EFh 84..146 CDD:238008 26/59 (44%)
AT1G62820NP_176470.1 PTZ00184 4..148 CDD:185504 58/139 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.