DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and CML37

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_199053.1 Gene:CML37 / 834244 AraportID:AT5G42380 Length:185 Species:Arabidopsis thaliana


Alignment Length:138 Identity:40/138 - (28%)
Similarity:78/138 - (56%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIM- 72
            :.|.:..|...|....|||:..||.:.:..||...:..|:::::..::.:.:|.::|.||..:| 
plant    47 VNELRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKLME 111

  Fly    73 AKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMIN 137
            .:...:.:..:|::|||.::..:|:.||:.|.||..:..|||..|.:....|||..|.:.||:::
plant   112 GEDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDDGVLS 176

  Fly   138 YEEFVWMI 145
            ::|||.|:
plant   177 FDEFVLMM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 40/138 (29%)
CML37NP_199053.1 PTZ00184 47..184 CDD:185504 39/136 (29%)

Return to query results.
Submit another query.