DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Calm4

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_064420.2 Gene:Calm4 / 80796 MGIID:1931464 Length:148 Species:Mus musculus


Alignment Length:138 Identity:56/138 - (40%)
Similarity:92/138 - (66%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFC 69
            |:|::|||:.||.:|||...|.|:..|||.:|:.||:|..|.:|:.||::.:.:.:|:::|.||.
Mouse     6 TKEEVAEFQAAFNRFDKNKDGHISVEELGDVMKQLGKNLPEKDLKALISKLDTDGDGKISFEEFL 70

  Fly    70 GIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDG 134
            ..:.| .::.....|:|..|.:.|::|||:|:..||:..:..|||.::.||:::|||.||.|.||
Mouse    71 TAIEK-YKKGHRAGELRAVFNVLDQNGDGYITVDELKESLSKLGESLSQEELEDMIRVADVDQDG 134

  Fly   135 MINYEEFV 142
            .:.|||||
Mouse   135 KVKYEEFV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 56/138 (41%)
EFh 11..73 CDD:238008 24/61 (39%)
EFh 84..146 CDD:238008 28/59 (47%)
Calm4NP_064420.2 PTZ00184 1..148 CDD:185504 56/138 (41%)
EFh 12..73 CDD:238008 24/60 (40%)
EFh 84..145 CDD:238008 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.