DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Calml4

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_612177.1 Gene:Calml4 / 75600 MGIID:1922850 Length:153 Species:Mus musculus


Alignment Length:143 Identity:50/143 - (34%)
Similarity:90/143 - (62%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68
            |:::||.|:|:.|..:||:..|||...:|...||.||.:||..|:|..:.....:.||:|:|:.|
Mouse     5 LSQDQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTF 69

  Fly    69 CGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGD 133
            ..||..|:::.|.::|:..|..:.|::..|:|..:|||..::.||||:|.:|:|::.:||..:.:
Mouse    70 LTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHKEVDDLFKEAGIEPN 134

  Fly   134 GMINYEEFVWMIS 146
            |.:.|:.|:..|:
Mouse   135 GQVKYDTFIQRIT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 50/143 (35%)
EFh 11..73 CDD:238008 23/61 (38%)
EFh 84..146 CDD:238008 20/61 (33%)
Calml4NP_612177.1 PTZ00184 1..144 CDD:185504 49/138 (36%)
EFh 12..74 CDD:238008 23/61 (38%)
EFh 94..147 CDD:298682 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.