DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and TNNC2

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_003270.1 Gene:TNNC2 / 7125 HGNCID:11944 Length:160 Species:Homo sapiens


Alignment Length:147 Identity:69/147 - (46%)
Similarity:101/147 - (68%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFT 66
            |.|:||.|||||.||..||.:|.|.|:.:||||:||.|||.||:.||..:|.|.:.:.:|.::|.
Human    10 SYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFE 74

  Fly    67 EFCGIMAKQMRET---DTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREA 128
            ||..:|.:||:|.   .:|||:.|.|:||||:.||:|.|.||..:....||.||||||:.::::.
Human    75 EFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDG 139

  Fly   129 DFDGDGMINYEEFVWMI 145
            |.:.||.|:::||:.|:
Human   140 DKNNDGRIDFDEFLKMM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 68/146 (47%)
EFh 11..73 CDD:238008 29/61 (48%)
EFh 84..146 CDD:238008 28/62 (45%)
TNNC2NP_003270.1 PTZ00184 12..156 CDD:185504 67/143 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006458
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.