DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and OCM

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001091091.1 Gene:OCM / 654231 HGNCID:8105 Length:109 Species:Homo sapiens


Alignment Length:91 Identity:24/91 - (26%)
Similarity:42/91 - (46%) Gaps:19/91 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KQMRETDTEE----------------EMREAFKIFDRDGDGFISPAELRFVMINL---GEKVTDE 119
            ::.|:.||.|                ::::.|:..|.|..|::...||:|.:...   ..::|:.
Human    17 QECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTES 81

  Fly   120 EIDEMIREADFDGDGMINYEEFVWMI 145
            |...::..||.||||.|..|||..|:
Human    82 ETKSLMAAADNDGDGKIGAEEFQEMV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 24/91 (26%)
EFh 11..73 CDD:238008
EFh 84..146 CDD:238008 20/65 (31%)
OCMNP_001091091.1 EFh_parvalbumin_beta 9..109 CDD:319998 24/91 (26%)
EF-hand motif 9..38 CDD:319998 4/20 (20%)
EF-hand motif 43..72 CDD:319998 7/28 (25%)
EF-hand motif 82..109 CDD:319998 12/26 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.