DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Tsc1

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_006498283.1 Gene:Tsc1 / 64930 MGIID:1929183 Length:1174 Species:Mus musculus


Alignment Length:104 Identity:21/104 - (20%)
Similarity:43/104 - (41%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFD 93
            |:|: .:|:|..:...|.....|:.:.:..:..|....|...::||:......:::..|..|   
Mouse   884 TKEV-EMMKTAYRKELEKNRSHLLQQNQRLDASQRRVLELESLLAKKDHLLLEQKKYLEDVK--- 944

  Fly    94 RDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDG 132
            ....|.:..||.|:.......:|.:.||.::....:.||
Mouse   945 SQASGQLLAAESRYEAQRKITRVLELEILDLYGRLEKDG 983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 21/104 (20%)
EFh 11..73 CDD:238008 8/43 (19%)
EFh 84..146 CDD:238008 11/49 (22%)
Tsc1XP_006498283.1 Hamartin 7..729 CDD:367919
Smc 715..>981 CDD:224117 19/100 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.