DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and ocm3

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001025657.1 Gene:ocm3 / 595049 XenbaseID:XB-GENE-5833501 Length:109 Species:Xenopus tropicalis


Alignment Length:81 Identity:25/81 - (30%)
Similarity:41/81 - (50%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINL---GEKVTDEEIDEMI 125
            :|.:.||:..|      :.:::|:.|:|.|||..|||...||:..:.|.   ...::..|....:
 Frog    29 SFFDKCGLTGK------SNDQVRKVFEILDRDKSGFIEEDELQLFLQNFKSNARALSAAETKAFL 87

  Fly   126 READFDGDGMINYEEF 141
            :..|.||||.|..:||
 Frog    88 KAGDSDGDGKIGVDEF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 25/81 (31%)
EFh 11..73 CDD:238008 3/8 (38%)
EFh 84..146 CDD:238008 21/61 (34%)
ocm3NP_001025657.1 EFh_parvalbumin_beta 9..109 CDD:319998 25/81 (31%)
EF-hand motif 9..38 CDD:319998 3/8 (38%)
EF-hand motif 43..72 CDD:319998 12/28 (43%)
EF-hand motif 82..109 CDD:319998 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.