DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and tnnc2.2

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_571638.1 Gene:tnnc2.2 / 58082 ZFINID:ZDB-GENE-000322-2 Length:160 Species:Danio rerio


Alignment Length:147 Identity:63/147 - (42%)
Similarity:105/147 - (71%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFT 66
            |.|:||.:||||.||..||.:|.|.|:|:||||:||.||||||..||:::|.|.:.:.:|.::|.
Zfish    10 SYLSEEMLAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTREELEEIIEEVDEDGSGSIDFE 74

  Fly    67 EFCGIMAKQMRETD---TEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREA 128
            ||..:|.:.::|..   :|||:.|.|::.|::|||:|...|...::.:.||.:::|||||::::.
Zfish    75 EFLVMMVRLLKEDQAGKSEEELAECFRVLDKNGDGYIDRDEFAEIIRSTGESISEEEIDELLKDG 139

  Fly   129 DFDGDGMINYEEFVWMI 145
            |.:.|||::::||:.|:
Zfish   140 DKNNDGMLDFDEFLKMM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 62/146 (42%)
EFh 11..73 CDD:238008 31/61 (51%)
EFh 84..146 CDD:238008 23/62 (37%)
tnnc2.2NP_571638.1 PTZ00184 12..156 CDD:185504 61/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006458
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.