DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cabp7b

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_683885.1 Gene:cabp7b / 556082 ZFINID:ZDB-GENE-060526-366 Length:213 Species:Danio rerio


Alignment Length:69 Identity:34/69 - (49%)
Similarity:48/69 - (69%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWM 144
            |..||:|||||:|||||:||||..||...|.:||....:.|::.:|:..|.||||.:::||||.:
Zfish    33 DEVEEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVAL 97

  Fly   145 ISQK 148
            :..|
Zfish    98 LGPK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 33/67 (49%)
EFh 11..73 CDD:238008
EFh 84..146 CDD:238008 31/61 (51%)
cabp7bXP_683885.1 EFh 37..98 CDD:238008 31/60 (52%)
EF-hand_7 38..98 CDD:290234 30/59 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.