powered by:
Protein Alignment Acam and cabp7b
DIOPT Version :9
Sequence 1: | NP_001163737.1 |
Gene: | Acam / 44913 |
FlyBaseID: | FBgn0011273 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_683885.1 |
Gene: | cabp7b / 556082 |
ZFINID: | ZDB-GENE-060526-366 |
Length: | 213 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 34/69 - (49%) |
Similarity: | 48/69 - (69%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 DTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWM 144
|..||:|||||:|||||:||||..||...|.:||....:.|::.:|:..|.||||.:::||||.:
Zfish 33 DEVEEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVAL 97
Fly 145 ISQK 148
:..|
Zfish 98 LGPK 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.