DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and CALML5

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_059118.2 Gene:CALML5 / 51806 HGNCID:18180 Length:146 Species:Homo sapiens


Alignment Length:146 Identity:65/146 - (44%)
Similarity:98/146 - (67%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTE 67
            |||.|:.|::|.||...|.:|.|.|..:|||..::..|:|.:||:|:.||:|.:::.:|:::|.|
Human     4 ELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQE 68

  Fly    68 FCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDG 132
            |. ..||:.|.  ..|:::.||:.||:||||.|:..|||..|..||:.:..||:|.||||||.|.
Human    69 FL-TAAKKARA--GLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQ 130

  Fly   133 DGMINYEEFVWMISQK 148
            ||.:|||||..|::|:
Human   131 DGRVNYEEFARMLAQE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 64/144 (44%)
EFh 11..73 CDD:238008 22/61 (36%)
EFh 84..146 CDD:238008 33/61 (54%)
CALML5NP_059118.2 PTZ00184 1..143 CDD:185504 63/141 (45%)
EFh 12..74 CDD:238008 22/62 (35%)
EFh 82..144 CDD:238008 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.