DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Calm5

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:126 Identity:44/126 - (34%)
Similarity:79/126 - (62%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FDKEGT--GKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDT 81
            |.||..  |.|..:|||.:|:.||:|.:..||:.||::.:.:.:|:::|.||    .|.:::...
Mouse     5 FTKEENKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEF----FKSIKKYTK 65

  Fly    82 EEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFV 142
            |:|::..|.:.|::|||:|:..||:..:..:||.::.||::.||.....|.||.:|||:|:
Mouse    66 EQELQAMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGADQDGKVNYEQFL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 44/126 (35%)
EFh 11..73 CDD:238008 20/55 (36%)
EFh 84..146 CDD:238008 22/59 (37%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 15/45 (33%)
EFh 35..94 CDD:238008 19/62 (31%)
EF-hand_7 36..91 CDD:290234 18/58 (31%)
EFh 68..128 CDD:238008 22/59 (37%)
EF-hand_7 69..129 CDD:290234 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.