DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and MYL1

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:144 Identity:54/144 - (37%)
Similarity:87/144 - (60%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENN--NNGQLNF 65
            |.::||..|||:||:.||:.|..||...::|.::|.||.|||.||::.::....|.  |..::.|
Human    46 EFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEF 110

  Fly    66 TEFCGIMAKQMRETD--TEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREA 128
            .:|..:|.......|  |.|:..|..::||::|:|.:..||||.|:..||||:.:||::.::...
Human   111 EQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQ 175

  Fly   129 DFDGDGMINYEEFV 142
            : |.:|.||||.||
Human   176 E-DSNGCINYEAFV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 54/144 (38%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 54/144 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.