DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cabp1a

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001315294.1 Gene:cabp1a / 449789 ZFINID:ZDB-GENE-041010-36 Length:379 Species:Danio rerio


Alignment Length:150 Identity:63/150 - (42%)
Similarity:96/150 - (64%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTE 67
            ||..|:|.|.:|||.:|||:..|.|:.::||..|||:|..|||.||.:|..:...|..|.::|.:
Zfish   230 ELRPEEIDELRDAFKEFDKDKDGFISCKDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFED 294

  Fly    68 FCGIMA-KQMRETDTE---EEMREAFKIFDRDGDGFISPAELRFVMIN-LGEKVTDEEIDEMIRE 127
            |..:|. |.:.||...   :|:|.|||.||.:|||.||..|||..|.. ||::|...::::::|:
Zfish   295 FVELMGPKLLAETADMIGIKELRNAFKEFDTNGDGEISTGELREAMRKLLGQQVGHRDLEDILRD 359

  Fly   128 ADFDGDGMINYEEFVWMISQ 147
            .|.:|||.:::||||.|:|:
Zfish   360 IDLNGDGRVDFEEFVRMVSR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 63/149 (42%)
EFh 11..73 CDD:238008 25/61 (41%)
EFh 84..146 CDD:238008 29/62 (47%)
cabp1aNP_001315294.1 PTZ00184 230..377 CDD:185504 61/146 (42%)
EFh 238..341 CDD:238008 44/102 (43%)
EFh 315..378 CDD:238008 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.