DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and pvalb6

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_991136.1 Gene:pvalb6 / 402806 ZFINID:ZDB-GENE-040912-95 Length:109 Species:Danio rerio


Alignment Length:87 Identity:30/87 - (34%)
Similarity:47/87 - (54%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVM---INLGEKVTDEEIDEMI 125
            :|.|..|:.||      ..:::::||.:.|.|..|||...||:||:   ...|..:||:|....:
Zfish    29 SFFEMVGLKAK------ASDDVKKAFHLLDADNSGFIEEEELKFVLKAFATDGRDLTDKETKAFL 87

  Fly   126 READFDGDGMINYEEFVWMISQ 147
            :.||.||||.|..|||..::.:
Zfish    88 QAADKDGDGKIGAEEFAALVRE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 30/87 (34%)
EFh 11..73 CDD:238008 3/8 (38%)
EFh 84..146 CDD:238008 25/64 (39%)
pvalb6NP_991136.1 EFh_parvalbumin_like 10..109 CDD:330177 30/85 (35%)
EF-hand motif 10..38 CDD:319994 3/8 (38%)
EF-hand motif 43..72 CDD:319994 11/28 (39%)
EF-hand motif 82..109 CDD:319994 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.