DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and calb2b

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_957005.1 Gene:calb2b / 393684 ZFINID:ZDB-GENE-040426-1668 Length:269 Species:Danio rerio


Alignment Length:176 Identity:43/176 - (24%)
Similarity:79/176 - (44%) Gaps:41/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTL-----GQNPTEAELQDLIAE----AE 56
            ::|||..|   |.|.:.:||.:|.|.|..:||...:|.|     ..:|:.|..:|.:.|    .:
Zfish    13 LAELTASQ---FLDIWNKFDADGNGCIEGKELENFIRELEIARKTADPSNASFKDRMKEFMQKFD 74

  Fly    57 NNNNGQLNFTEFCGIMAKQMRETDTEE--------------EMREAFKIFDRDGDGFISPAELRF 107
            .|.:|::..:|...|:       .|||              |...|::.:|.|..|:|...||:.
Zfish    75 ENGDGKIEMSELAQIL-------PTEENFLLCFRQFVGSSAEFMTAWRKYDTDRSGYIESNELKG 132

  Fly   108 VMINLGEKV----TDEEIDE----MIREADFDGDGMINYEEFVWMI 145
            .:.:|.:|.    .|::::|    :::..|.:|||.:...|...::
Zfish   133 FLSDLLKKANRHYNDKKLNEYTQTILKMFDLNGDGKLGLSEMARLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 43/174 (25%)
EFh 11..73 CDD:238008 19/70 (27%)
EFh 84..146 CDD:238008 17/70 (24%)
calb2bNP_957005.1 PTZ00184 13..178 CDD:185504 43/174 (25%)
EFh 20..90 CDD:238008 19/72 (26%)
EFh 109..178 CDD:238008 17/68 (25%)
EF-hand_7 155..218 CDD:290234 5/24 (21%)
EFh 157..223 CDD:238008 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.