DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and CG11041

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_611453.2 Gene:CG11041 / 37278 FlyBaseID:FBgn0034481 Length:155 Species:Drosophila melanogaster


Alignment Length:145 Identity:47/145 - (32%)
Similarity:78/145 - (53%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAEN-NNNGQLNFT 66
            :|..:......|||..||..|...|..||:||::|.||..|||.|:.::|:..|: ..:|:::.|
  Fly     4 DLNNDLEKRISDAFCVFDHHGDKFIDVREVGTVLRLLGCVPTEEEVNEVISATESEETSGEVHLT 68

  Fly    67 EFCGIMAKQMRETDTE----EEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIRE 127
            :|...:::.:.|...|    |::.:||||.|.:..|:::......:|:..||..|.||:|||...
  Fly    69 KFLPHVSQLLMERKMEPAPPEKILQAFKILDPENKGYLTKESFGKLMMEEGEPFTQEEMDEMWPV 133

  Fly   128 ADFDGDGMINYEEFV 142
            |.....|.|.||.::
  Fly   134 AIDPISGHIPYEFYL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 47/145 (32%)
EFh 11..73 CDD:238008 23/62 (37%)
EFh 84..146 CDD:238008 20/59 (34%)
CG11041NP_611453.2 EF-hand_6 12..41 CDD:290141 12/28 (43%)
PTZ00184 15..152 CDD:185504 46/134 (34%)
EFh 90..>130 CDD:298682 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.