DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and TpnC47D

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster


Alignment Length:147 Identity:55/147 - (37%)
Similarity:94/147 - (63%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTE 67
            :||.||||..:.||..||.:.||.|.|..:..::|.:||......|.:||.|.:.:.:|:|.|.|
  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEE 71

  Fly    68 FCGIMAKQMRETDTE---EEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREAD 129
            |..:.||.:.|.|.|   :|:||||:::|:.|:|:|..:.|:.::..|.:::|::|:|.||.|.|
  Fly    72 FVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEID 136

  Fly   130 FDGDGMINYEEFVWMIS 146
            .||.|.::::||:.|::
  Fly   137 SDGSGTVDFDEFMEMMT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 55/147 (37%)
EFh 11..73 CDD:238008 20/61 (33%)
EFh 84..146 CDD:238008 24/61 (39%)
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 55/146 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.