DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and azot

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:61/148 - (41%)
Similarity:101/148 - (68%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNF 65
            |.:::.|:.....|.|...||:..|.|.::|:..::|.||:.|.:||:|.:|.|.::..||.:..
  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65

  Fly    66 TEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADF 130
            .|||.::.::||:|:.|:|:||||:|||:|.:|:|:..||:.|...||.|::|:|::|||||.|.
  Fly    66 PEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDL 130

  Fly   131 DGDGMINYEEFVWMISQK 148
            |.|..:||||||.|::.:
  Fly   131 DQDNHLNYEEFVNMMTMR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 60/144 (42%)
EFh 11..73 CDD:238008 21/61 (34%)
EFh 84..146 CDD:238008 34/61 (56%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 61/146 (42%)
EFh 12..72 CDD:238008 21/59 (36%)
EFh 84..146 CDD:238008 34/61 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443689
Domainoid 1 1.000 82 1.000 Domainoid score I1952
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.