DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Calml3

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001012054.1 Gene:Calml3 / 307100 RGDID:1305499 Length:149 Species:Rattus norvegicus


Alignment Length:147 Identity:92/147 - (62%)
Similarity:124/147 - (84%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFT 66
            ::||||||||||:||..|||:|.|.|.|:||||:||:||||||||||||::.|.:.:.||.::|.
  Rat     3 NQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQDMVNEIDKDGNGTVDFP 67

  Fly    67 EFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFD 131
            ||..:|:::|::||:|||:||||::||:||:||:|.||||.||..||||::|||:||||:.||.|
  Rat    68 EFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIQAADTD 132

  Fly   132 GDGMINYEEFVWMISQK 148
            |||.:||||||.|:..|
  Rat   133 GDGQVNYEEFVHMLVSK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 91/144 (63%)
EFh 11..73 CDD:238008 36/61 (59%)
EFh 84..146 CDD:238008 42/61 (69%)
Calml3NP_001012054.1 PTZ00184 1..149 CDD:185504 91/145 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.