DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Cabp5

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_038905.1 Gene:Cabp5 / 29865 MGIID:1352746 Length:173 Species:Mus musculus


Alignment Length:149 Identity:66/149 - (44%)
Similarity:102/149 - (68%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68
            |.::::.|.::||::|||:..|.|:.::||.||||:|..|||.||.:|..:...|..|:::|.:|
Mouse    25 LGQDELDELREAFLEFDKDQDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDF 89

  Fly    69 CGIMA-KQMRETD---TEEEMREAFKIFDRDGDGFISPAELRFVMIN-LGEKVTDEEIDEMIREA 128
            ..:|. |.:.||.   ..:|||:|||.||.:|||.|:.|||:..|.. ||||:|..||.|:::||
Mouse    90 VELMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIAEVVQEA 154

  Fly   129 DFDGDGMINYEEFVWMISQ 147
            |.:|||.:::||||.|:|:
Mouse   155 DINGDGTVDFEEFVKMMSR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 66/149 (44%)
EFh 11..73 CDD:238008 25/61 (41%)
EFh 84..146 CDD:238008 35/62 (56%)
Cabp5NP_038905.1 PTZ00184 25..171 CDD:185504 64/145 (44%)
EFh 32..94 CDD:238008 25/61 (41%)
EFh 109..172 CDD:238008 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.