DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Efcab2

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_038946462.1 Gene:Efcab2 / 289280 RGDID:1308593 Length:179 Species:Rattus norvegicus


Alignment Length:167 Identity:54/167 - (32%)
Similarity:81/167 - (48%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAE----FKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNN-NGQ 62
            |.||..:||    .|:||..||.|....:..||:||::|:||.:|||.||.|.|||.|... .|.
  Rat     8 ESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGY 72

  Fly    63 LNFTEFCGIMAKQMRETD----TEEEMREAFKIFDRDGDGFISPAELRFVM-------------- 109
            :.|.:|..:|...:.|..    .|:.:..||::.|....||::..||...|              
  Rat    73 IRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLE 137

  Fly   110 INL-GEKVTDEEIDEMIREADFDGDGMINYEEFVWMI 145
            :.| ||..:.||::||:..|.......|||.:::.|:
  Rat   138 LELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 54/167 (32%)
EFh 11..73 CDD:238008 27/66 (41%)
EFh 84..146 CDD:238008 20/77 (26%)
Efcab2XP_038946462.1 PTZ00184 22..175 CDD:185504 49/153 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.