DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and PC1

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001318585.1 Gene:PC1 / 28721170 AraportID:AT5G17480 Length:83 Species:Arabidopsis thaliana


Alignment Length:66 Identity:29/66 - (43%)
Similarity:39/66 - (59%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 MRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEE 140
            |.:...:.|....||.||.:|||.||.|||...:..|| .||.:::..|:.|.|.||||.|:|:|
plant     1 MADATEKAEHDRIFKKFDANGDGKISAAELEEALKTLG-SVTADDVKRMMAEIDTDGDGNISYQE 64

  Fly   141 F 141
            |
plant    65 F 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 29/66 (44%)
PC1NP_001318585.1 EFh 12..68 CDD:238008 27/55 (49%)

Return to query results.
Submit another query.