DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and AT3G03430

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001319459.1 Gene:AT3G03430 / 28718660 AraportID:AT3G03430 Length:83 Species:Arabidopsis thaliana


Alignment Length:67 Identity:32/67 - (47%)
Similarity:41/67 - (61%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 MRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEE 140
            |.:...:.|....||.||.:|||.||.|||...:.||| .||.|:|..|:.|.|.||||.|:|:|
plant     1 MADATEKAEHDRIFKKFDANGDGKISAAELGDALKNLG-SVTHEDIKRMMAEIDTDGDGYISYQE 64

  Fly   141 FV 142
            |:
plant    65 FI 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 32/67 (48%)
AT3G03430NP_001319459.1 EFh 12..70 CDD:238008 30/56 (54%)

Return to query results.
Submit another query.