DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and T27C10.9

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001317774.1 Gene:T27C10.9 / 28661657 WormBaseID:WBGene00269435 Length:127 Species:Caenorhabditis elegans


Alignment Length:116 Identity:50/116 - (43%)
Similarity:69/116 - (59%) Gaps:15/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGF 99
            |:..|...||....|.|:.|..|:            ::|:: ..|.||||:|:.|:..|:|||||
 Worm     7 LLIVLAWIPTFGSTQGLLDELTND------------LLARK-HLTKTEEEIRKVFQDLDKDGDGF 58

  Fly   100 ISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEF--VWMISQK 148
            ||.|||:.||.||...:|:||||:.||.||..|||:::.|||  |.|.||:
 Worm    59 ISVAELQAVMTNLQAWLTEEEIDDGIRSADISGDGLVDLEEFIDVTMHSQQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 49/114 (43%)
EFh 11..73 CDD:238008 8/37 (22%)
EFh 84..146 CDD:238008 35/63 (56%)
T27C10.9NP_001317774.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.